PDB entry 1bm3

View 1bm3 on RCSB PDB site
Description: immunoglobulin opg2 fab-peptide complex
Deposited on 1999-04-15, released 1999-01-13
The last revision prior to the SCOP 1.69 freeze date was dated 2000-02-14, with a file datestamp of 2000-02-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.152
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1bm3H (H:)
    evqlvqsggglvnpgrslklscaasgftfssygmswvrqtpekrlewvaaisgggtyihy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyyctrhpfyrydggnyyamdhwgqgts
    vtvsaakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bm3H (H:)
    evqlvqsggglvnpgrslklscaasgftfssygmswvrqtpekrlewvaaisgggtyihy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyyctrhamdhwgqgtsvtvsaakttpp
    svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bm3L (L:)
    delltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyasqsisgips
    rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpltfgggskleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec