PDB entry 1bm2

View 1bm2 on RCSB PDB site
Description: grb2-sh2 domain in complex with cyclo-[n-alpha-acetyl-l-thi alysyl-o-phosphotyrosyl-valyl-asparagyl-valyl-prolyl] (pkf273-791)
Class: hormone/growth factor
Keywords: sh2 domain, signal transduction, adaptor protein, ras pathway, cyclic peptide, hormone/growth factor complex
Deposited on 1998-07-27, released 1998-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (growth factor receptor bound protein 2)
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bm2a_
  • Chain 'L':
    Compound: protein (pkf273-791)
    Database cross-references and differences (RAF-indexed):
    • PDB 1BM2 (Start-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bm2A (A:)
    gspknyiemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvq
    hfkvlrdgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bm2A (A:)
    mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
    agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'L':
    No sequence available.