PDB entry 1bm2

View 1bm2 on RCSB PDB site
Description: grb2-sh2 domain in complex with cyclo-[n-alpha-acetyl-l-thi alysyl-o- phosphotyrosyl-valyl-asparagyl-valyl-prolyl] (pkf273-791)
Deposited on 1998-07-27, released 1998-08-05
The last revision prior to the SCOP 1.61 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1bm2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bm2A (A:)
  mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
  agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie