PDB entry 1bm1

View 1bm1 on RCSB PDB site
Description: crystal structure of bacteriorhodopsin in the light-adapted state
Class: photoreceptor
Keywords: proton pump, membrane protein, retinal protein, photoreceptor
Deposited on 1998-07-28, released 1999-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.26
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriorhodopsin
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bm1a_
  • Heterogens: RET, DPG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bm1A (A:)
    eaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapepsa
    gdgaaats
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bm1A (A:)
    rpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygl
    tmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvga
    ltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsayp
    vvwligsegagivplnietllfmvldvsakvgfglillrsr