PDB entry 1blz

View 1blz on RCSB PDB site
Description: isopenicillin n synthase from aspergillus nidulans (acv-fe-no complex)
Deposited on 1998-07-22, released 1999-01-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.2054
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1blz__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1blz_ (-)
    skanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefhms
    itpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktpth
    evnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtlasv
    vlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdiea
    ddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprepng
    ksdreplsygdylqnglvslinkngqt