PDB entry 1blz

View 1blz on RCSB PDB site
Description: isopenicillin n synthase from aspergillus nidulans (acv-fe-no complex)
Class: b-lactam antibiotic
Keywords: b-lactam antibiotic, oxygenase, penicillin biosynthesis
Deposited on 1998-07-22, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.205
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isopenicillin n synthase
    Species: Emericella nidulans [TaxId:162425]
    Gene: PCB C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1blza_
  • Heterogens: FE, ACV, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1blzA (A:)
    mgsvskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktke
    fhmsitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqak
    tpthevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddt
    lasvvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyq
    dieaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdpr
    epngksdreplsygdylqnglvslinkngqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1blzA (A:)
    skanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefhms
    itpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktpth
    evnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtlasv
    vlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdiea
    ddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprepng
    ksdreplsygdylqnglvslinkngqt