PDB entry 1blv

View 1blv on RCSB PDB site
Description: solution structure of oxidized rat microsomal cytochrome b5 in the presence of 2 m guanidinium chloride: monitoring the early steps in protein unfolding
Class: electron transport
Keywords: protein unfolding, nmr solution structure, cytochrome b5, electron transport
Deposited on 1998-07-21, released 1998-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (cytochrome b5)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00173 (0-93)
  Domains in SCOPe 2.08: d1blva_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1blvA (A:)
  dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
  vghstdarelsktyiigelhpddrskiakpsetl