PDB entry 1blr

View 1blr on RCSB PDB site
Description: nmr solution structure of human cellular retinoic acid binding protein-type II, 22 structures
Class: transport
Keywords: crabpii, vitamin a, transport
Deposited on 1998-07-20, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellular retinoic acid binding protein-type II
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP-II
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1blra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1blrA (A:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
    ltmtaddvvctrvyvre