PDB entry 1blq

View 1blq on RCSB PDB site
Description: structure and interaction site of the regulatory domain of troponin-c when complexed with the 96-148 region of troponin-i, nmr, 29 structures
Deposited on 1998-07-19, released 1999-01-13
The last revision prior to the SCOP 1.71 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: NMR29
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1blq__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1blq_ (-)
    asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
    iieevdedgsgtidfeeflvmmvrqmkeda