PDB entry 1blq

View 1blq on RCSB PDB site
Description: structure and interaction site of the regulatory domain of troponin-c when complexed with the 96-148 region of troponin-I, nmr, 29 structures
Class: calcium-binding protein
Keywords: calcium-binding, regulation, troponin c, skeletal muscle, contraction, calcium-binding protein
Deposited on 1998-07-19, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: n-troponin c
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02588 (0-89)
  Domains in SCOPe 2.08: d1blqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1blqA (A:)
  asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
  iieevdedgsgtidfeeflvmmvrqmkeda