PDB entry 1blp

View 1blp on RCSB PDB site
Description: structural basis for the inactivation of the p54 mutant of beta-lactamase from staphylococcus aureus pc1
Class: hydrolase(acting on cyclic amides)
Keywords: hydrolase(acting on cyclic amides)
Deposited on 1993-09-23, released 1994-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.181
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00807 (0-256)
      • engineered mutation (145)
    Domains in SCOPe 2.07: d1blpa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1blpA (A:)
    kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
    kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
    elgdkvtnpvryeielnyyspkskkntstpaafgktlnkliangklskenkkflldlmln
    nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
    pndklisetaksvmkef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1blpA (A:)
    kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
    kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
    elgdkvtnpvrlnyyspkskkntstpaafgktlnkliangklskenkkflldlmlnnksg
    dtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdkpndk
    lisetaksvmkef