PDB entry 1bln

View 1bln on RCSB PDB site
Description: anti-p-glycoprotein fab mrk-16
Class: immune system
Keywords: immunoglobulin
Deposited on 1998-07-16, released 1998-10-28
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.209
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (monoclonal antibody mrk-16 (light chain))
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1blna1, d1blna2
  • Chain 'B':
    Compound: protein (monoclonal antibody mrk-16 (heavy chain))
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1blnb1, d1blnb2
  • Chain 'C':
    Compound: protein (monoclonal antibody mrk-16 (light chain))
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1blnc1, d1blnc2
  • Chain 'D':
    Compound: protein (monoclonal antibody mrk-16 (heavy chain))
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1blnd1, d1blnd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1blnA (A:)
    dvlmtqtpvslsvslgdqasiscrssqsivhstgntylewylqkpgqspklliykisnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqashaprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceatspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1blnB (B:)
    evilvesggglvkpggslklscaasgftfssytmswvrqtpekrlewvatissgggntyy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyycaryyryeawfaswgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1blnC (C:)
    dvlmtqtpvslsvslgdqasiscrssqsivhstgntylewylqkpgqspklliykisnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqashaprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceatspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1blnD (D:)
    evilvesggglvkpggslklscaasgftfssytmswvrqtpekrlewvatissgggntyy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyycaryyryeawfaswgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep