PDB entry 1bll

View 1bll on RCSB PDB site
Description: x-ray crystallographic determination of the structure of bovine lens leucine aminopeptidase complexed with amastatin: formulation of a catalytic mechanism featuring a gem-diolate transition state
Class: hydrolase/hydrolase inhibitor
Keywords: ALPHA-AMINOACYLPEPTIDE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1993-03-02, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: leucine aminopeptidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00727 (0-End)
      • conflict (44)
    Domains in SCOPe 2.07: d1blle1, d1blle2
  • Chain 'I':
    Compound: amastatin
    Database cross-references and differences (RAF-indexed):
    • PDB 1BLL (0-3)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1bllE (E:)
    tkglvlgiyskekeedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhed
    fpsvvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaa
    egavlglyeyddlkqkrkvvvsaklhgsedqeawqrgvlfasgqnlarrlmetpanemtp
    tkfaeiveenlksasiktdvfirpkswieeqemgsflsvakgseeppvfleihykgspna
    sepplvfvgkgitfdsggisikaaanmdlmradmggaaticsaivsaakldlpinivgla
    plcenmpsgkankpgdvvrarngktiqvdntdaegrliladalcyahtfnpkviinaatl
    tgamdialgsgatgvftnsswlwnklfeasietgdrvwrmplfehytrqvidcqladvnn
    igkyrsagactaaaflkefvthpkwahldiagvmtnkdevpylrkgmagrptrtlieflf
    rfsqdsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bllE (E:)
    tkglvlgiyskedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhedfps
    vvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaaega
    vlglyeyddlkqkrkvvvsaklhgsedqeawqrgvlfasgqnlarrlmetpanemtptkf
    aeiveenlksasiktdvfirpkswieeqemgsflsvakgseeppvfleihykgspnasep
    plvfvgkgitfdsggisikaaanmdlmradmggaaticsaivsaakldlpinivglaplc
    enmpsgkankpgdvvrarngktiqvdntdaegrliladalcyahtfnpkviinaatltga
    mdialgsgatgvftnsswlwnklfeasietgdrvwrmplfehytrqvidcqladvnnigk
    yrsagactaaaflkefvthpkwahldiagvmtnkdevpylrkgmagrptrtlieflfrfs
    q
    

  • Chain 'I':
    No sequence available.