PDB entry 1bli

View 1bli on RCSB PDB site
Description: bacillus licheniformis alpha-amylase
Class: hydrolase
Keywords: hydrolase, glycosyltransferase, alpha-amylase, starch degradation, alpha-1,4-glucan-4-glucanohydrolase, thermostability, calcium, sodium
Deposited on 1998-01-07, released 1999-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.154
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Bacillus licheniformis [TaxId:1402]
    Gene: AMYL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06278 (Start-482)
      • conflict (133)
      • engineered mutation (189)
      • engineered mutation (263-264)
      • conflict (309)
      • conflict (319)
      • conflict (464)
    Domains in SCOPe 2.07: d1blia1, d1blia2
  • Heterogens: CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bliA (A:)
    anlngtlmqyfewympndgqhwkrlqndsaylaehgitavwippaykgtsqadvgygayd
    lydlgefhqkgtvrtkygtkgelqsaikslhsrdinvygdvvinhkggadatedvtavev
    dpadrnrvisgehlikawthfhfpgrgstysdfkwhwyhfdgtdwdesrklnriykfqgk
    awdwevsnefgnydylmyadidydhpdvaaeikrwgtwyanelqldgfrldavkhikfsf
    lrdwvnhvrektgkemftvaeywsydlgalenylnktnfnhsvfdvplhyqfhaastqgg
    gydmrkllngtvvskhplksvtfvdnhdtqpgqslestvqtwfkplayafiltresgypq
    vfygdmygtkgdsqreipalkhkiepilkarkqyaygaqhdyfdhhdivgwtregdssva
    nsglaalitdgpggakrmyvgrqnagetwhditgnrsepvvinsagwgefhvnggsvsiy
    vqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bliA (A:)
    lngtlmqyfewympndgqhwkrlqndsaylaehgitavwippaykgtsqadvgygaydly
    dlgefhqkgtvrtkygtkgelqsaikslhsrdinvygdvvinhkggadatedvtavevdp
    adrnrvisgehlikawthfhfpgrgstysdfkwhwyhfdgtdwdesrklnriykfqgkaw
    dwevsnefgnydylmyadidydhpdvaaeikrwgtwyanelqldgfrldavkhikfsflr
    dwvnhvrektgkemftvaeywsydlgalenylnktnfnhsvfdvplhyqfhaastqgggy
    dmrkllngtvvskhplksvtfvdnhdtqpgqslestvqtwfkplayafiltresgypqvf
    ygdmygtkgdsqreipalkhkiepilkarkqyaygaqhdyfdhhdivgwtregdssvans
    glaalitdgpggakrmyvgrqnagetwhditgnrsepvvinsagwgefhvnggsvsiyvq
    r