PDB entry 1blf

View 1blf on RCSB PDB site
Description: structure of diferric bovine lactoferrin at 2.8 angstroms resolution
Class: iron-binding protein
Keywords: lactoferrin, transferrin, iron-binding protein, carbohydrate structure
Deposited on 1997-08-20, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.232
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactoferrin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1blfa1, d1blfa2
  • Heterogens: NAG, FE, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1blfA (A:)
    aprknvrwctisqpewfkcrrwqwrmkklgapsitcvrrafaleciraiaekkadavtld
    ggmvfeagrdpyklrpvaaeiygtkespqthyyavavvkkgsnfqldqlqgrkschtglg
    rsagwiipmgilrpylswtesleplqgavakffsascvpcidrqaypnlcqlckgegenq
    cacssrepyfgysgafkclqdgagdvafvkettvfenlpekadrdqyellclnnsrapvd
    afkechlaqvpshavvarsvdgkedliwkllskaqekfgknksrsfqlfgsppgqrdllf
    kdsalgflripskvdsalylgsrylttlknlretaeevkarytrvvwcavgpeeqkkcqq
    wsqqsgqnvtcatasttddcivlvlkgeadalnldggyiytagkcglvpvlaenrksskh
    ssldcvlrptegylavavvkkanegltwnslkdkkschtavdrtagwnipmglivnqtgs
    cafdeffsqscapgadpksrlcalcagddqgldkcvpnskekyygytgafrclaedvgdv
    afvkndtvwentngestadwaknlnredfrllcldgtrkpvteaqschlavapnhavvsr
    sdraahvkqvllhqqalfgkngkncpdkfclfksetknllfndnteclaklggrptyeey
    lgteyvtaianlkkcstsplleacafltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1blfA (A:)
    nvrwctisqpewfkcrrwqwrmkklgapsitcvrrafaleciraiaekkadavtldggmv
    feagrdpyklrpvaaeiygtkespqthyyavavvkkgsnfqldqlqgrkschtglgrsag
    wiipmgilrpylswtesleplqgavakffsascvpcidrqaypnlcqlckgegenqcacs
    srepyfgysgafkclqdgagdvafvkettvfenlpekadrdqyellclnnsrapvdafke
    chlaqvpshavvarsvdgkedliwkllskaqekfgknksrsfqlfgsppgqrdllfkdsa
    lgflripskvdsalylgsrylttlknlretaeevkarytrvvwcavgpeeqkkcqqwsqq
    sgqnvtcatasttddcivlvlkgeadalnldggyiytagkcglvpvlaenrksskhssld
    cvlrptegylavavvkkanegltwnslkdkkschtavdrtagwnipmglivnqtgscafd
    effsqscapgadpksrlcalcagddqgldkcvpnskekyygytgafrclaedvgdvafvk
    ndtvwentngestadwaknlnredfrllcldgtrkpvteaqschlavapnhavvsrsdra
    ahvkqvllhqqalfgkngkncpdkfclfksetknllfndnteclaklggrptyeeylgte
    yvtaianlkkcstsplleacafltr