PDB entry 1bld

View 1bld on RCSB PDB site
Description: basic fibroblast growth factor (fgf-2) mutant with cys 78 replaced by ser and cys 96 replaced by ser, nmr
Class: growth factor
Keywords: growth factor
Deposited on 1996-05-20, released 1996-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: basic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038 (0-154)
      • conflict (2)
      • conflict (4)
      • engineered (77)
      • engineered (95)
    Domains in SCOPe 2.07: d1blda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bldA (A:)
    maegeittlpalpedggsgafppghfkdpkrlycknggfflrihpdgrvdgvreksdphi
    klqlqaeergvvsikgvsanrylamkedgrllasksvtdecffferlesnnyntyrsrky
    tswyvalkrtgqyklgsktgpgqkailflpmsaks