PDB entry 1bld

View 1bld on RCSB PDB site
Description: basic fibroblast growth factor (fgf-2) mutant with cys 78 replaced by ser and cys 96 replaced by ser, nmr
Class: growth factor
Keywords: growth factor
Deposited on 1996-05-20, released 1996-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: basic fibroblast growth factor
  Species: Homo sapiens [TaxId:9606]
  Gene: CDNA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09038 (0-154)
    • conflict (2)
    • conflict (4)
    • engineered (77)
    • engineered (95)
  Domains in SCOPe 2.08: d1blda_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bldA (A:)
  maegeittlpalpedggsgafppghfkdpkrlycknggfflrihpdgrvdgvreksdphi
  klqlqaeergvvsikgvsanrylamkedgrllasksvtdecffferlesnnyntyrsrky
  tswyvalkrtgqyklgsktgpgqkailflpmsaks