PDB entry 1blc

View 1blc on RCSB PDB site
Description: inhibition of beta-lactamase by clavulanate: trapped intermediates in cryocrystallographic studies
Class: hydrolase(acting in cyclic amides)
Keywords: hydrolase(acting in cyclic amides)
Deposited on 1993-09-27, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.179
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1blca_
  • Heterogens: SO4, CEM, TEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1blcA (A:)
    kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
    kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
    elgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
    nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
    pndklisetaksvmkef