PDB entry 1blb

View 1blb on RCSB PDB site
Description: close packing of an oligomeric eye lens beta-crystallin induces loss of symmetry and ordering of sequence extensions
Class: eye lens protein
Keywords: eye lens protein
Deposited on 1993-12-22, released 1994-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta b2-crystallin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1blba1, d1blba2
  • Chain 'B':
    Compound: beta b2-crystallin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1blbb1, d1blbb2
  • Chain 'C':
    Compound: beta b2-crystallin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1blbc1, d1blbc2
  • Chain 'D':
    Compound: beta b2-crystallin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1blbd1, d1blbd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1blbA (A:)
    asdhqtqagkpqplnpkiiifeqenfqghshelngpcpnlketgvekagsvlvqagpwvg
    yeqanckgeqfvfekgeyprwdswtssrrtdslsslrpikvdsqehkitlyenpnftgkk
    mevidddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglqyllekgdykdsgdfgapq
    pqvqsvrrirdmqwhqrgafhpss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1blbA (A:)
    kpqplnpkiiifeqenfqghshelngpcpnlketgvekagsvlvqagpwvgyeqanckge
    qfvfekgeyprwdswtssrrtdslsslrpikvdsqehkitlyenpnftgkkmevidddvp
    sfhahgyqekvssvrvqsgtwvgyqypgyrglqyllekgdykdsgdfgapqpqvqsvrri
    rdmqw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1blbB (B:)
    asdhqtqagkpqplnpkiiifeqenfqghshelngpcpnlketgvekagsvlvqagpwvg
    yeqanckgeqfvfekgeyprwdswtssrrtdslsslrpikvdsqehkitlyenpnftgkk
    mevidddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglqyllekgdykdsgdfgapq
    pqvqsvrrirdmqwhqrgafhpss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1blbB (B:)
    lnpkiiifeqenfqghshelngpcpnlketgvekagsvlvqagpwvgyeqanckgeqfvf
    ekgeyprwdswtssrrtdslsslrpikvdsqehkitlyenpnftgkkmevidddvpsfha
    hgyqekvssvrvqsgtwvgyqypgyrglqyllekgdykdsgdfgapqpqvqsvrrirdmq
    w
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1blbC (C:)
    asdhqtqagkpqplnpkiiifeqenfqghshelngpcpnlketgvekagsvlvqagpwvg
    yeqanckgeqfvfekgeyprwdswtssrrtdslsslrpikvdsqehkitlyenpnftgkk
    mevidddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglqyllekgdykdsgdfgapq
    pqvqsvrrirdmqwhqrgafhpss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1blbC (C:)
    agkpqplnpkiiifeqenfqghshelngpcpnlketgvekagsvlvqagpwvgyeqanck
    geqfvfekgeyprwdswtssrrtdslsslrpikvdsqehkitlyenpnftgkkmeviddd
    vpsfhahgyqekvssvrvqsgtwvgyqypgyrglqyllekgdykdsgdfgapqpqvqsvr
    rirdmqw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1blbD (D:)
    asdhqtqagkpqplnpkiiifeqenfqghshelngpcpnlketgvekagsvlvqagpwvg
    yeqanckgeqfvfekgeyprwdswtssrrtdslsslrpikvdsqehkitlyenpnftgkk
    mevidddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglqyllekgdykdsgdfgapq
    pqvqsvrrirdmqwhqrgafhpss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1blbD (D:)
    qplnpkiiifeqenfqghshelngpcpnlketgvekagsvlvqagpwvgyeqanckgeqf
    vfekgeyprwdswtssrrtdslsslrpikvdsqehkitlyenpnftgkkmevidddvpsf
    hahgyqekvssvrvqsgtwvgyqypgyrglqyllekgdykdsgdfgapqpqvqsvrrird
    mqw