PDB entry 1bl9

View 1bl9 on RCSB PDB site
Description: conformational changes occurring upon reduction in nitrite reductase from pseudomonas aeruginosa
Class: oxidoreductase
Keywords: nitrite reductase, pseudomonas aeruginosa, hemoprotein, denitrification, domain swapping, conformational changes, reduction, oxidoreductase, electron transport
Deposited on 1998-07-20, released 1999-04-27
The last revision prior to the SCOP 1.73 freeze date was dated 1999-04-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.2107
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1bl9a1, d1bl9a2
  • Chain 'B':
    Compound: nitrite reductase
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1bl9b1, d1bl9b2
  • Heterogens: OH, HEC, DHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bl9A (A:)
    kddmkaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatg
    kpltpditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewg
    mpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgya
    vhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedryt
    iagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvke
    tgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsa
    lvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqg
    ggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakr
    vvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqh
    dvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bl9A (A:)
    aeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltpd
    itqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewgmpemre
    swkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgyavhisrm
    sasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedrytiagayw
    ppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvketgkvll
    vnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsalvdvgk
    tphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqgggslfi
    kthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakrvvqpey
    nkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqhdvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bl9B (B:)
    kddmkaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatg
    kpltpditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewg
    mpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgya
    vhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedryt
    iagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvke
    tgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsa
    lvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqg
    ggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakr
    vvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqh
    dvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bl9B (B:)
    aeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltpd
    itqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewgmpemre
    swkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgyavhisrm
    sasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedrytiagayw
    ppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvketgkvll
    vnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsalvdvgk
    tphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqgggslfi
    kthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakrvvqpey
    nkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqhdvy