PDB entry 1bl8

View 1bl8 on RCSB PDB site
Description: potassium channel (kcsa) from streptomyces lividans
Class: membrane protein
Keywords: potassium channel, integral membrane protein, membrane protein
Deposited on 1998-07-23, released 1998-07-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.28
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (potassium channel protein)
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-96)
      • engineered (67)
    Domains in SCOPe 2.03: d1bl8a_
  • Chain 'B':
    Compound: protein (potassium channel protein)
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-96)
      • engineered (67)
    Domains in SCOPe 2.03: d1bl8b_
  • Chain 'C':
    Compound: protein (potassium channel protein)
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-96)
      • engineered (67)
    Domains in SCOPe 2.03: d1bl8c_
  • Chain 'D':
    Compound: protein (potassium channel protein)
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-96)
      • engineered (67)
    Domains in SCOPe 2.03: d1bl8d_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bl8A (A:)
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bl8B (B:)
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bl8C (C:)
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bl8D (D:)
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq