PDB entry 1bl5

View 1bl5 on RCSB PDB site
Description: isocitrate dehydrogenase from e. coli single turnover laue structure of rate-limited product complex, 10 msec time resolution
Class: oxidoreductase
Keywords: oxidoreductase, nad(a)-choh(d), phosphorylation
Deposited on 1998-07-23, released 1999-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ICD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bl5a_
  • Heterogens: MG, AKG, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bl5A (A:)
    skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
    iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqel
    dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
    mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
    dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
    nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
    mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm