PDB entry 1bl4
View 1bl4 on RCSB PDB site
Description: fkbp mutant f36v complexed with remodeled synthetic ligand
Class: isomerase
Keywords: isomerase, rotamase
Deposited on
1998-07-23, released
1998-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-04-18, with a file datestamp of
2018-04-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (fk506 binding protein)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1bl4a_ - Chain 'B':
Compound: protein (fk506 binding protein)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1bl4b_ - Heterogens: AP1, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1bl4A (A:)
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkvdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1bl4B (B:)
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkvdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle