PDB entry 1bl1

View 1bl1 on RCSB PDB site
Description: pth receptor n-terminus fragment, nmr, 1 structure
Class: hormone receptor
Keywords: hormone receptor, parathyroid hormone, micelle structures, calciotropic hormones, nmr structures
Deposited on 1998-07-22, released 1999-03-30
The last revision prior to the SCOP 1.75 freeze date was dated 1999-03-30, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: parathyroid hormone receptor
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03431 (0-29)
    • conflict (2)
  Domains in SCOP 1.75: d1bl1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bl1A (A:)
  seavkfltnetrerevfdrlgmiytvgysvc