PDB entry 1bl1

View 1bl1 on RCSB PDB site
Description: pth receptor n-terminus fragment, nmr, 1 structure
Class: hormone receptor
Keywords: hormone receptor, parathyroid hormone, micelle structures, calciotropic hormones, nmr structures
Deposited on 1998-07-22, released 1999-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parathyroid hormone receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03431 (0-29)
      • conflict (2)
    Domains in SCOPe 2.08: d1bl1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bl1A (A:)
    seavkfltnetrerevfdrlgmiytvgysvc