PDB entry 1bl0

View 1bl0 on RCSB PDB site
Description: multiple antibiotic resistance protein (mara)/dna complex
Deposited on 1998-07-22, released 1998-09-02
The last revision prior to the SCOP 1.57 freeze date was dated 2000-01-12, with a file datestamp of 2000-01-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.225
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bl0A (A:)
daitihsildwiednlesplslekvsersgyskwhlqrmfkketghslgqyirsrkmtei
aqklkesnepilylaerygfesqqtltrtfknyfdvpphkyrmtnmqgesrflhpl