PDB entry 1bkz

View 1bkz on RCSB PDB site
Description: crystal structure of human galectin-7
Deposited on 1998-07-13, released 1998-11-04
The last revision prior to the SCOP 1.61 freeze date was dated 1998-11-04, with a file datestamp of 1998-11-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1bkza_
  • Chain 'B':
    Domains in SCOP 1.61: d1bkzb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkzA (A:)
    snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
    fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
    vevggdvqldsvrif
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkzB (B:)
    snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
    fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
    vevggdvqldsvrif