PDB entry 1bky

View 1bky on RCSB PDB site
Description: vaccinia methyltransferase vp39 complexed with m1cyt and s-adenosylhomocysteine
Deposited on 1998-07-13, released 1999-07-22
The last revision prior to the SCOP 1.55 freeze date was dated 2000-10-27, with a file datestamp of 2000-10-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.227
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1bky__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1bky_ (-)
    mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
    gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
    lrsikkqlhpskiilisdvrskrggnepstadllsnyalqnvmisilnpvasslkwrcpf
    pdqwikdfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyyln
    kivrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bky_ (-)
    mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
    gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
    lrsikkqlhpskiilisdvrspstadllsnyalqnvmisilnpvasslkwrcpfpdqwik
    dfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyylnkivrnk
    vvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip