PDB entry 1bky

View 1bky on RCSB PDB site
Description: vaccinia methyltransferase vp39 complexed with m1cyt and s-adenosylhomocysteine
Class: mRNA processing
Keywords: methylated cytosine, methyltransferase, RNA cap analog, poly(a) polymerase, vaccinia, mRNA processing, transcription, complex (transferase/RNA cap analog)
Deposited on 1998-07-13, released 1999-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.227
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp39
    Species: Vaccinia virus [TaxId:10245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bkya_
  • Heterogens: SAH, 1MC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bkyA (A:)
    mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
    gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
    lrsikkqlhpskiilisdvrskrggnepstadllsnyalqnvmisilnpvasslkwrcpf
    pdqwikdfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyyln
    kivrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflniptts
    tekvshe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bkyA (A:)
    mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
    gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
    lrsikkqlhpskiilisdvrspstadllsnyalqnvmisilnpvasslkwrcpfpdqwik
    dfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyylnkivrnk
    vvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip