PDB entry 1bku

View 1bku on RCSB PDB site
Description: effects of glycosylation on the structure and dynamics of eel calcitonin, nmr, 10 structures
Class: hormone
Keywords: hormone, calcium-regulating hormone
Deposited on 1998-07-13, released 1999-01-13
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcitonin
    Species: Anguilla japonica
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1bkua_
  • Heterogens: NH2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkuA (A:)
    csnlstcvlgklsqelhklqtyprtdvgagtp