PDB entry 1bku

View 1bku on RCSB PDB site
Description: effects of glycosylation on the structure and dynamics of eel calcitonin, nmr, 10 structures
Class: hormone
Keywords: hormone, calcium-regulating hormone
Deposited on 1998-07-13, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calcitonin
  Species: Anguilla japonica [TaxId:7937]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01262 (0-31)
  Domains in SCOPe 2.08: d1bkua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bkuA (A:)
  csnlstcvlgklsqelhklqtyprtdvgagtp