PDB entry 1bkt

View 1bkt on RCSB PDB site
Description: bmktx toxin from scorpion buthus martensii karsch, nmr, 25 structures
Class: neurotoxin
Keywords: scorpion, neurotoxin, nmr, structure, large conductance potassium channel, voltage gated potassium channel, buthus martensii
Deposited on 1998-07-03, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bmktx
    Species: Mesobuthus martensii [TaxId:34649]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bkta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bktA (A:)
    vginvkckhsgqclkpckdagmrfgkcingkcdctpk