PDB entry 1bkr

View 1bkr on RCSB PDB site
Description: calponin homology (ch) domain from human beta-spectrin at 1.1 angstrom resolution
Class: actin-binding
Keywords: filamentous actin-binding domain, cytoskeleton
Deposited on 1998-07-10, released 1998-07-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.141
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spectrin beta chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1bkra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bkrA (A:)
    kksakdalllwcqmktagypnvnihnfttswrdgmafnalihkhrpdlidfdklkksnah
    ynlqnafnlaeqhlgltklldpedisvdhpdeksiityvvtyyhyfskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bkrA (A:)
    ksakdalllwcqmktagypnvnihnfttswrdgmafnalihkhrpdlidfdklkksnahy
    nlqnafnlaeqhlgltklldpedisvdhpdeksiityvvtyyhyfskm