PDB entry 1bkq

View 1bkq on RCSB PDB site
Description: solution nmr structure of pin: a protein inhibitor of neuronal nitric oxide synthase, 20 structures
Deposited on 1998-07-09, released 1999-02-16
The last revision was dated 2001-02-28, with a file datestamp of 2007-04-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1bkq_ (-)
mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
nfgsyvthetkhfiyfylgqvaillfksg

  • Chain 'p':
    No sequence available.