PDB entry 1bko

View 1bko on RCSB PDB site
Description: thermostable thymidylate synthase a from bacillus subtilis
Class: methyltransferase
Keywords: methyltransferase, dtmp synthase
Deposited on 1998-07-09, released 1999-02-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.213
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate synthase a
    Species: Bacillus subtilis [TaxId:1423]
    Gene: thyA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bkoa_
  • Chain 'B':
    Compound: thymidylate synthase a
    Species: Bacillus subtilis [TaxId:1423]
    Gene: thyA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bkob_
  • Chain 'C':
    Compound: thymidylate synthase a
    Species: Bacillus subtilis [TaxId:1423]
    Gene: thyA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bkoc_
  • Chain 'D':
    Compound: thymidylate synthase a
    Species: Bacillus subtilis [TaxId:1423]
    Gene: thyA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bkod_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkoA (A:)
    tqfdkqynsiikdiinngisdeefdvrtkwdsdgtpahtlsviskqmrfdnsevpilttk
    kvawktaikellwiwqlksndvndlnmmgvhiwdqwkqedgtighaygfqlgkknrslng
    ekvdqvdyllhqlknnpssrrhitmlwnpdeldamaltpcvyetqwyvkhgklhlevrar
    sndmalgnpfnvfqynvlqrmiaqvtgyelgeyifnigdchvytrhidnlkiqmereqfe
    apelwinpevkdfydftiddfklinykhgdkllfevav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkoB (B:)
    tqfdkqynsiikdiinngisdeefdvrtkwdsdgtpahtlsviskqmrfdnsevpilttk
    kvawktaikellwiwqlksndvndlnmmgvhiwdqwkqedgtighaygfqlgkknrslng
    ekvdqvdyllhqlknnpssrrhitmlwnpdeldamaltpcvyetqwyvkhgklhlevrar
    sndmalgnpfnvfqynvlqrmiaqvtgyelgeyifnigdchvytrhidnlkiqmereqfe
    apelwinpevkdfydftiddfklinykhgdkllfevav
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkoC (C:)
    tqfdkqynsiikdiinngisdeefdvrtkwdsdgtpahtlsviskqmrfdnsevpilttk
    kvawktaikellwiwqlksndvndlnmmgvhiwdqwkqedgtighaygfqlgkknrslng
    ekvdqvdyllhqlknnpssrrhitmlwnpdeldamaltpcvyetqwyvkhgklhlevrar
    sndmalgnpfnvfqynvlqrmiaqvtgyelgeyifnigdchvytrhidnlkiqmereqfe
    apelwinpevkdfydftiddfklinykhgdkllfevav
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkoD (D:)
    tqfdkqynsiikdiinngisdeefdvrtkwdsdgtpahtlsviskqmrfdnsevpilttk
    kvawktaikellwiwqlksndvndlnmmgvhiwdqwkqedgtighaygfqlgkknrslng
    ekvdqvdyllhqlknnpssrrhitmlwnpdeldamaltpcvyetqwyvkhgklhlevrar
    sndmalgnpfnvfqynvlqrmiaqvtgyelgeyifnigdchvytrhidnlkiqmereqfe
    apelwinpevkdfydftiddfklinykhgdkllfevav