PDB entry 1bkm

View 1bkm on RCSB PDB site
Description: cocrystal structure of d-amino acid substituted phosphopeptide complex
Class: transforming protein
Keywords: v-src sh2 domain, phosphotyrosine recognition domain, pp60 src sh2 domain, tripeptide, d-amino acid, transforming protein
Deposited on 1997-05-02, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pp60 v-src tyrosine kinase transforming protein
    Species: Rous sarcoma virus [TaxId:11886]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00524
      • conflict (17)
    Domains in SCOPe 2.07: d1bkma_
  • Heterogens: 1C5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bkmA (A:)
    gsaeewyfgkitrresealllnpenprgtflvresettkgayclsvsdfdnakglnvkhy
    kirkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcptskefivtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bkmA (A:)
    eewyfgkitrresealllnpenprgtflvresettkgayclsvsdfdnakglnvkhykir
    kldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt