PDB entry 1bkj

View 1bkj on RCSB PDB site
Description: nadph:fmn oxidoreductase from vibrio harveyi
Class: oxidoreductase
Keywords: oxidoreductase, luminescence, nadp, flavoprotein
Deposited on 1998-07-08, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nadph-flavin oxidoreductase
    Species: Vibrio harveyi [TaxId:669]
    Gene: VIBRIO HARVEYI NADPH:FMN OXIDOREDUCTASE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bkja_
  • Chain 'B':
    Compound: nadph-flavin oxidoreductase
    Species: Vibrio harveyi [TaxId:669]
    Gene: VIBRIO HARVEYI NADPH:FMN OXIDOREDUCTASE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bkjb_
  • Heterogens: PO4, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bkjA (A:)
    mnntietilahrsirkftavpitdeqrqtiiqaglaassssmlqvvsivrvtdsekrnel
    aqfagnqayvesaaeflvfcidyqrhatinpdvqadfteltligavdsgimaqncllaae
    smglggvyigglrnsaaqvdellglpensavlfgmclghpdqnpevkprlpahvvvhenq
    yqelnlddiqsydqtmqayyasrtsnqklstwsqevtgklagesrphilpylnskglakr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bkjA (A:)
    nntietilahrsirkftavpitdeqrqtiiqaglaassssmlqvvsivrvtdsekrnela
    qfagnqayvesaaeflvfcidyqrhatinpdvqadfteltligavdsgimaqncllaaes
    mglggvyigglrnsaaqvdellglpensavlfgmclghpdqnpevkprlpahvvvhenqy
    qelnlddiqsydqtmqayystwsqevtgklagesrphilpylnskglakr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bkjB (B:)
    mnntietilahrsirkftavpitdeqrqtiiqaglaassssmlqvvsivrvtdsekrnel
    aqfagnqayvesaaeflvfcidyqrhatinpdvqadfteltligavdsgimaqncllaae
    smglggvyigglrnsaaqvdellglpensavlfgmclghpdqnpevkprlpahvvvhenq
    yqelnlddiqsydqtmqayyasrtsnqklstwsqevtgklagesrphilpylnskglakr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bkjB (B:)
    nntietilahrsirkftavpitdeqrqtiiqaglaassssmlqvvsivrvtdsekrnela
    qfagnqayvesaaeflvfcidyqrhatinpdvqadfteltligavdsgimaqncllaaes
    mglggvyigglrnsaaqvdellglpensavlfgmclghpdqnpevkprlpahvvvhenqy
    qelnlddiqsydqtmqayystwsqevtgklagesrphilpylnskglakr