PDB entry 1bkh

View 1bkh on RCSB PDB site
Description:
Deposited on 1998-07-07, released 1998-10-21
The last revision prior to the SCOP 1.71 freeze date was dated 1998-10-21, with a file datestamp of 1998-10-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.157
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1bkha1, d1bkha2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1bkhb1, d1bkhb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1bkhc1, d1bkhc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkhA (A:)
    alieridaiivdlptiqqtlvvlrvrcsdgvegigeattigglaygyespegikanidah
    lapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellggrvrd
    slevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelgdsas
    vrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimadesies
    vedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtlasah
    afltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldeqrlarfar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkhB (B:)
    alieridaiivdlptirpqqqtlvvlrvrcsdgvegigeattigglaygyespegikani
    dahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellggr
    vrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelgd
    sasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimades
    iesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtla
    sahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldeqrlarfa
    r
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkhC (C:)
    alieridaiivdlptiqqqtlvvlrvrcsdgvegigeattigglaygyespegikanida
    hlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellggrvr
    dslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelgdsa
    svrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimadesie
    svedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtlasa
    hafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldeqrlarfar