PDB entry 1bkh

View 1bkh on RCSB PDB site
Description: muconate lactonizing enzyme from pseudomonas putida
Class: muconate cycloisomerase
Keywords: muconate lactonizing enzyme, muconate cycloisomerase aromatic hydrocarbons catabolism, isomerase, muconate cycloisomerase
Deposited on 1998-07-07, released 1998-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.157
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: muconate lactonizing enzyme
    Species: Pseudomonas putida [TaxId:303]
    Gene: CATB
    Database cross-references and differences (RAF-indexed):
    • GB AAA66202 (0-368)
      • conflict (134)
    Domains in SCOPe 2.07: d1bkha1, d1bkha2
  • Chain 'B':
    Compound: muconate lactonizing enzyme
    Species: Pseudomonas putida [TaxId:303]
    Gene: CATB
    Database cross-references and differences (RAF-indexed):
    • GB AAA66202 (0-368)
      • conflict (134)
    Domains in SCOPe 2.07: d1bkhb1, d1bkhb2
  • Chain 'C':
    Compound: muconate lactonizing enzyme
    Species: Pseudomonas putida [TaxId:303]
    Gene: CATB
    Database cross-references and differences (RAF-indexed):
    • GB AAA66202 (0-368)
      • conflict (134)
    Domains in SCOPe 2.07: d1bkhc1, d1bkhc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bkhA (A:)
    alieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattigglaygyes
    pegikanidahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglp
    vsellggrvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvv
    tikrelgdsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtp
    apimadesiesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtml
    egsigtlasahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltld
    eqrlarfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bkhA (A:)
    alieridaiivdlptiqqtlvvlrvrcsdgvegigeattigglaygyespegikanidah
    lapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellggrvrd
    slevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelgdsas
    vrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimadesies
    vedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtlasah
    afltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldeqrlarfar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bkhB (B:)
    alieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattigglaygyes
    pegikanidahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglp
    vsellggrvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvv
    tikrelgdsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtp
    apimadesiesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtml
    egsigtlasahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltld
    eqrlarfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bkhB (B:)
    alieridaiivdlptirpqqqtlvvlrvrcsdgvegigeattigglaygyespegikani
    dahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellggr
    vrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelgd
    sasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimades
    iesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtla
    sahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldeqrlarfa
    r
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bkhC (C:)
    alieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattigglaygyes
    pegikanidahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglp
    vsellggrvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvv
    tikrelgdsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtp
    apimadesiesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtml
    egsigtlasahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltld
    eqrlarfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bkhC (C:)
    alieridaiivdlptiqqqtlvvlrvrcsdgvegigeattigglaygyespegikanida
    hlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellggrvr
    dslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelgdsa
    svrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimadesie
    svedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtlasa
    hafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldeqrlarfar