PDB entry 1bkf

View 1bkf on RCSB PDB site
Description: fk506 binding protein fkbp mutant r42k/h87v complex with immunosuppressant fk506
Class: isomerase
Keywords: isomerase, rotamase
Deposited on 1995-10-18, released 1996-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fk506 binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62942 (0-106)
      • engineered (41)
      • engineered (86)
    Domains in SCOPe 2.08: d1bkfa_
  • Heterogens: FK5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkfA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdknkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatgvpgiipphatlvfdvellkle