PDB entry 1bkc

View 1bkc on RCSB PDB site
Description: catalytic domain of tnf-alpha converting enzyme (tace)
Deposited on 1998-04-23, released 1999-06-22
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-22, with a file datestamp of 1999-06-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bkca_
  • Chain 'C':
    Domains in SCOP 1.55: d1bkcc_
  • Chain 'E':
    Domains in SCOP 1.55: d1bkce_
  • Chain 'I':
    Domains in SCOP 1.55: d1bkci_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkcA (A:)
    dpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiq
    ieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlf
    tyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltke
    adlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsi
    yktieskaqecfqer
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkcC (C:)
    mkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiqie
    qirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlfty
    qdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltkead
    lvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsiyk
    tieskaqecfqers
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkcE (E:)
    dpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiq
    ieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlf
    tyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltke
    adlvtthelghnfgaehdpdgkaecapnedqggkyvmypiavsgdhennkmfsqcskqsi
    yktieskaqecfqers
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkcI (I:)
    mkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiqie
    qirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlfty
    qdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltkead
    lvtthelghnfgaehdpdglaecapneeqggkyvmypiavsgdhennkmfsqcskqsiyk
    tieskaqecfqers