PDB entry 1bkc

View 1bkc on RCSB PDB site
Description: catalytic domain of tnf-alpha converting enzyme (tace)
Class: zn-endopeptidase
Keywords: zn-endopeptidase, hydrolase, tnf-alpha
Deposited on 1998-04-23, released 1999-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor-alpha-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78536 (0-End)
      • engineered (47)
      • engineered (233)
    Domains in SCOPe 2.07: d1bkca_
  • Chain 'C':
    Compound: tumor necrosis factor-alpha-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78536 (Start-255)
      • engineered (47)
      • engineered (233)
    Domains in SCOPe 2.07: d1bkcc_
  • Chain 'E':
    Compound: tumor necrosis factor-alpha-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78536 (0-255)
      • engineered (47)
      • conflict (201)
      • engineered (233)
    Domains in SCOPe 2.07: d1bkce_
  • Chain 'I':
    Compound: tumor necrosis factor-alpha-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78536 (Start-255)
      • engineered (47)
      • conflict (209)
      • engineered (233)
    Domains in SCOPe 2.07: d1bkci_
  • Heterogens: ZN, INN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bkcA (A:)
    dpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiq
    ieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlf
    tyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltke
    adlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsi
    yktieskaqecfqers
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bkcA (A:)
    dpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiq
    ieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlf
    tyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltke
    adlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsi
    yktieskaqecfqer
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bkcC (C:)
    dpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiq
    ieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlf
    tyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltke
    adlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsi
    yktieskaqecfqers
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bkcC (C:)
    mkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiqie
    qirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlfty
    qdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltkead
    lvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsiyk
    tieskaqecfqers
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkcE (E:)
    dpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiq
    ieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlf
    tyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltke
    adlvtthelghnfgaehdpdgkaecapnedqggkyvmypiavsgdhennkmfsqcskqsi
    yktieskaqecfqers
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1bkcI (I:)
    dpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiq
    ieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlf
    tyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltke
    adlvtthelghnfgaehdpdglaecapneeqggkyvmypiavsgdhennkmfsqcskqsi
    yktieskaqecfqers
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bkcI (I:)
    mkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiqie
    qirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlfty
    qdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltkead
    lvtthelghnfgaehdpdglaecapneeqggkyvmypiavsgdhennkmfsqcskqsiyk
    tieskaqecfqers