PDB entry 1bkb

View 1bkb on RCSB PDB site
Description: initiation factor 5a from archebacterium pyrobaculum aerophilum
Class: translation
Keywords: translation initiation factor
Deposited on 1998-07-05, released 1998-11-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.214
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: translation initiation factor 5a
  Species: Pyrobaculum aerophilum [TaxId:13773]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56635 (0-135)
    • conflict (3)
    • conflict (90)
    • conflict (92)
    • conflict (102)
  Domains in SCOPe 2.05: d1bkba1, d1bkba2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bkbA (A:)
  kwvmstkyveagelkegsyvvidgepcrvveieksktgkhgsakarivavgvfdggkrtl
  slpvdaqvevpiiekftaqilsvsgdviqlmdmrdyktievpmkyveeeakgrlapgaev
  evwqildrykiirvkg