PDB entry 1bkb

View 1bkb on RCSB PDB site
Description: initiation factor 5a from archebacterium pyrobaculum aerophilum
Class: translation
Keywords: translation initiation factor
Deposited on 1998-07-05, released 1998-11-04
The last revision prior to the SCOP 1.75 freeze date was dated 1999-12-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.214
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: translation initiation factor 5a
    Species: Pyrobaculum aerophilum
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56635 (0-135)
      • conflict (3)
      • conflict (90)
      • conflict (92)
      • conflict (102)
    Domains in SCOP 1.75: d1bkba1, d1bkba2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bkbA (A:)
    kwvmstkyveagelkegsyvvidgepcrvveieksktgkhgsakarivavgvfdggkrtl
    slpvdaqvevpiiekftaqilsvsgdviqlmdmrdyktievpmkyveeeakgrlapgaev
    evwqildrykiirvkg