PDB entry 1bkb

View 1bkb on RCSB PDB site
Description: initiation factor 5a from archebacterium pyrobaculum aerophilum
Deposited on 1998-07-05, released 1998-11-04
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.214
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bkb_ (-)
kwvmstkyveagelkegsyvvidgepcrvveieksktgkhgsakarivavgvfdggkrtl
slpvdaqvevpiiekftaqilsvsgdviqlmdmrdyktievpmkyveeeakgrlapgaev
evwqildrykiirvkg