PDB entry 1bka

View 1bka on RCSB PDB site
Description: oxalate-substituted diferric lactoferrin
Class: iron binding protein
Keywords: anion binding, iron binding protein
Deposited on 1996-04-15, released 1996-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.196
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactoferrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bkaa1, d1bkaa2
  • Heterogens: FE, OXL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bkaA (A:)
    grrrsvqwcavsqpeatkcfqwqrnmrkvrgppvscikrdspiqciqaiaenradavtld
    ggfiyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglr
    rtagwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenk
    cafssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvd
    kfkdchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllf
    kdsaigfsrvppridsglylgsgyftaiqnlrkseeevaarrarvvwcavgeqelrkcnq
    wsglsegsvtcssasttedcialvlkgeadamsldggyvytagkcglvpvlaenyksqqs
    sdpdpncvdrpvegylavavvrrsdtsltwnsvkgkkschtavdrtagwnipmgllfnqt
    gsckfdeyfsqscapgsdprsnlcalcigdeqgenkcvpnsneryygytgafrclaenag
    dvafvkdvtvlqntdgnnneawakdlkladfallcldgkrkpvtearschlamapnhavv
    srmdkverlkqvllhqqakfgrngsdcpdkfclfqsetknllfndnteclarlhgkttye
    kylgpqyvagitnlkkcstsplleaceflrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bkaA (A:)
    rsvqwcavsqpeatkcfqwqrnmrkvrgppvscikrdspiqciqaiaenradavtldggf
    iyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglrrta
    gwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenkcaf
    ssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvdkfk
    dchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllfkds
    aigfsrvppridsglylgsgyftaiqnlrkseeevaarrarvvwcavgeqelrkcnqwsg
    lsegsvtcssasttedcialvlkgeadamsldggyvytagkcglvpvlaenyksqqssdp
    dpncvdrpvegylavavvrrsdtsltwnsvkgkkschtavdrtagwnipmgllfnqtgsc
    kfdeyfsqscapgsdprsnlcalcigdeqgenkcvpnsneryygytgafrclaenagdva
    fvkdvtvlqntdgnnneawakdlkladfallcldgkrkpvtearschlamapnhavvsrm
    dkverlkqvllhqqakfgrngsdcpdkfclfqsetknllfndnteclarlhgkttyekyl
    gpqyvagitnlkkcstsplleaceflrk