PDB entry 1bk9

View 1bk9 on RCSB PDB site
Description: phospholipase a2 modified by pbpb
Class: hydrolase
Keywords: hydrolase, phospholipase a2, platelet aggregation inhibitor, pbpb
Deposited on 1998-07-16, released 1999-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Gloydius halys [TaxId:8714]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14418 (0-123)
  Domains in SCOPe 2.08: d1bk9a_
• Heterogens: CA, PBP, BU1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bk9A (A:)
  sliqfetlimkvakksgmfwysnygcycgwggqgrpqdatdrccfvhdccygkvtgcdpk
  mdvysfseengdivcggddpckkeicecdraaaicfrdnltlyndkkywafgakncpqee
  sepc