PDB entry 1bk9

View 1bk9 on RCSB PDB site
Description: phospholipase a2 modified by pbpb
Class: hydrolase
Keywords: hydrolase, phospholipase a2, platelet aggregation inhibitor, pbpb
Deposited on 1998-07-16, released 1999-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bk9a_
  • Heterogens: CA, PBP, BU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bk9A (A:)
    sliqfetlimkvakksgmfwysnygcycgwggqgrpqdatdrccfvhdccygkvtgcdpk
    mdvysfseengdivcggddpckkeicecdraaaicfrdnltlyndkkywafgakncpqee
    sepc