PDB entry 1bk8

View 1bk8 on RCSB PDB site
Description: determination of the three-dimensional solution structure of aesculus hippocastanum antimicrobial protein 1 (ah-amp1) by 1h nmr, 25 structures
Class: plant defensin
Keywords: plant defensin, antimicrobial, cysteine-stabilized alfa/ beta motif
Deposited on 1998-07-15, released 2000-01-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: antimicrobial protein 1
  Species: Aesculus hippocastanum [TaxId:43364]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7M1F3 (0-49)
  Domains in SCOPe 2.08: d1bk8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bk8A (A:)
  lcnerpsqtwsgncgntahcdkqcqdwekashgachkrenhwkcfcyfnc