PDB entry 1bk7

View 1bk7 on RCSB PDB site
Description: ribonuclease mc1 from the seeds of bitter gourd
Class: hydrolase
Keywords: hydrolase (nucleic acid, RNA)
Deposited on 1998-07-15, released 1999-07-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.192
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribonuclease mc1)
    Species: Momordica charantia [TaxId:3673]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23540 (0-189)
      • conflict (39)
    Domains in SCOPe 2.06: d1bk7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bk7A (A:)
fdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkish
lqsqlntlwpnvlrannqqfwshewtkhgtcsestfnqaayfklavdmrnnydiigalrp
haagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvqvvacfaqdgstlidct
rdtcganfif