PDB entry 1bk6

View 1bk6 on RCSB PDB site
Description: karyopherin alpha (yeast) + sv40 t antigen nls
Class: complex (protein transport/peptide)
Keywords: protein transport, nls nuclear import, armadillo repeat containing protein, complex (protein transport/peptide)
Deposited on 1998-07-14, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.256
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: karyopherin alpha
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene: SRP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02821 (0-421)
      • conflict (367)
    Domains in SCOPe 2.07: d1bk6a_
  • Chain 'B':
    Compound: karyopherin alpha
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene: SRP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02821 (0-421)
      • conflict (367)
    Domains in SCOPe 2.07: d1bk6b_
  • Chain 'C':
    Compound: large t antigen
    Database cross-references and differences (RAF-indexed):
    • PDB 1BK6 (0-5)
  • Chain 'D':
    Compound: large t antigen
    Database cross-references and differences (RAF-indexed):
    • PDB 1BK6 (0-4)
  • Chain 'E':
    Compound: large t antigen
    Database cross-references and differences (RAF-indexed):
    • PDB 1BK6 (0-5)
  • Chain 'F':
    Compound: large t antigen
    Database cross-references and differences (RAF-indexed):
    • PDB 1BK6 (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bk6A (A:)
    lpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpemlq
    leaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdyr
    dyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliys
    mdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgnivt
    gndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlippl
    vkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriievt
    ldaleniikmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiety
    fg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bk6B (B:)
    lpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpemlq
    leaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdyr
    dyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliys
    mdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgnivt
    gndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlippl
    vkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriievt
    ldaleniikmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiety
    fg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.