PDB entry 1bk5

View 1bk5 on RCSB PDB site
Description: karyopherin alpha from saccharomyces cerevisiae
Class: protein transport
Keywords: protein transport, nls nuclear import, armadillo repeat containing protein
Deposited on 1998-07-14, released 1999-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.237
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: karyopherin alpha
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene: SRP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bk5a_
  • Chain 'B':
    Compound: karyopherin alpha
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene: SRP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bk5b_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bk5A (A:)
    lpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpemlq
    leaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdyr
    dyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliys
    mdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgnivt
    gndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlippl
    vkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriievt
    ldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiety
    fg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bk5B (B:)
    lpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpemlq
    leaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdyr
    dyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliys
    mdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgnivt
    gndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlippl
    vkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriievt
    ldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiety
    fg